PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr033910.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family LBD
Protein Properties Length: 214aa    MW: 22959 Da    PI: 5.5909
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr033910.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260136.78.1e-43461451100
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +CaaCk+lrr+Ca++Cvlapyfp ++p+kf ++h++FGasn++kll++lp+++r da+ss+vyeA ar+rdPvyG++g i +lq+q+++l+a+la+++
  Pbr033910.1  46 PCAACKILRRRCADKCVLAPYFPPSEPAKFTIAHRVFGASNIIKLLQELPDSQRADAVSSMVYEASARIRDPVYGCAGAICHLQKQVNELQAQLAKAQ 143
                  7**********************************************************************************************999 PP

       DUF260  99 ee 100
                  +e
  Pbr033910.1 144 AE 145
                  76 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.93545146IPR004883Lateral organ boundaries, LOB
PfamPF031954.4E-4346143IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005739Cellular Componentmitochondrion
Sequence ? help Back to Top
Protein Sequence    Length: 214 aa     Download sequence    Send to blast
MECSTETMNT NYTTTSSTMS QSPPSSSPSS PPTLTPTPSP TVVVSPCAAC KILRRRCADK  60
CVLAPYFPPS EPAKFTIAHR VFGASNIIKL LQELPDSQRA DAVSSMVYEA SARIRDPVYG  120
CAGAICHLQK QVNELQAQLA KAQAEVVNMQ CQQANLVALI CMEMSQPNSE QGSPPQSLDH  180
NFVTTIPHGG NQTNLGFLDD STTLGSLWDP LWT*
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009338292.11e-158PREDICTED: LOB domain-containing protein 1-like
RefseqXP_009358251.11e-158PREDICTED: LOB domain-containing protein 1-like
SwissprotQ9LQR05e-78LBD1_ARATH; LOB domain-containing protein 1
TrEMBLM5W0701e-111M5W070_PRUPE; Uncharacterized protein
STRINGGLYMA13G40370.25e-97(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF130334106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28500.11e-67LOB domain-containing protein 11